| Product Number |
ARP42318_P050 |
| Product Page |
www.avivasysbio.com/slc20a2-antibody-n-terminal-region-arp42318-p050.html |
| Name |
SLC20A2 Antibody - N-terminal region (ARP42318_P050) |
| Protein Size (# AA) |
652 amino acids |
| Molecular Weight |
70 kDa |
| NCBI Gene Id |
6575 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 20 (phosphate transporter), member 2 |
| Alias Symbols |
PIT2, RAM1, GLVR2, IBGC1, IBGC2, IBGC3, MLVAR, PIT-2, Ram-1, GLVR-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Bottger,P. (2005) FEBS J. 272 (12), 3060-3074 |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-SLC20A2 (ARP42318_P050) antibody |
| Blocking Peptide |
For anti-SLC20A2 (ARP42318_P050) antibody is Catalog # AAP42318 (Previous Catalog # AAPP12590) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC20A2 |
| Uniprot ID |
Q08357 |
| Protein Name |
Sodium-dependent phosphate transporter 2 |
| Protein Accession # |
NP_006740 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006749 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC20A2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human PANC1 Whole Cell
 | Host: Rabbit
Target Name: SLC20A2
Sample Tissue: Human PANC1 Whole Cell
Antibody Dilution: 1ug/ml |
|
| Image 2 | Human HepG2
 | WB Suggested Anti-SLC20A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
