SLC22A7 antibody - N-terminal region (ARP42306_T100)
Data Sheet
Product Number ARP42306_T100
Product Page
Product Name SLC22A7 antibody - N-terminal region (ARP42306_T100)
Thumbnail Label Jurkat
Size 100 ul
Gene Symbol SLC22A7
Alias Symbols MGC24091, MGC45202, NLT, OAT2
Protein Size (# AA) 546 amino acids
Molecular Weight 60kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 10864
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Solute carrier family 22 (organic anion transporter), member 7
Description This is a rabbit polyclonal antibody against SLC22A7. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQS
Target Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Description of Target SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-SLC22A7 (ARP42306_T100) antibody is Catalog # AAP42306 (Previous Catalog # AAPS12303)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A7
Complete computational species homology data Anti-SLC22A7 (ARP42306_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SLC22A7.
Swissprot Id Q5T048
Protein Name Solute carrier family 22 member 7
Sample Type Confirmation

There is BioGPS gene expression data showing that SLC22A7 is expressed in Jurkat

Protein Accession # NP_006663
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SLC22A7.
Nucleotide Accession # NM_006672
Replacement Item This antibody may replace item sc-132388 from Santa Cruz Biotechnology.
Conjugation Options

ARP42306_T100-FITC Conjugated

ARP42306_T100-HRP Conjugated

ARP42306_T100-Biotin Conjugated

CB Replacement sc-132388
Species Reactivity Cow, Guinea Pig, Horse, Human, Rabbit, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Rabbit: 79%; Rat: 86%
Image 1
Human Muscle
Rabbit Anti-SLC22A7 Antibody
Catalog Number: ARP42306
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Jurkat
WB Suggested Anti-SLC22A7 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate

There is BioGPS gene expression data showing that SLC22A7 is expressed in Jurkat

Image 3

Host: Rabbit
Target Name: SLC22A7
Sample Type: Jurkat
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 2.5ug/mL
Peptide Concentration: 2.0ug/mL
Lysate Quantity: 25ug/lane
Gel Concentration: 12%

There is BioGPS gene expression data showing that SLC22A7 is expressed in Jurkat


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |