| Product Number |
ARP42287_T100 |
| Product Page |
www.avivasysbio.com/fst-antibody-c-terminal-region-arp42287-t100.html |
| Name |
FST Antibody - C-terminal region (ARP42287_T100) |
| Protein Size (# AA) |
317 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
10468 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Follistatin |
| Alias Symbols |
FS |
| Peptide Sequence |
Synthetic peptide located within the following region: SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Saito,S., (2005) Endocrinology 146 (12), 5052-5062 |
| Description of Target |
Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release.Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin. |
| Protein Interactions |
INHBA; BMPR2; BMPR1A; C8orf33; TK1; MEST; INHBE; INHA; FN1; BMP5; TXN; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FST (ARP42287_T100) antibody |
| Blocking Peptide |
For anti-FST (ARP42287_T100) antibody is Catalog # AAP42287 (Previous Catalog # AAPS12109) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human FST |
| Uniprot ID |
Q6FHE1 |
| Protein Name |
FST protein EMBL CAG46612.1 |
| Protein Accession # |
NP_006341 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_006350 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FST |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-FST Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
|
