NNMT Antibody - N-terminal region (ARP42281_T100)

Data Sheet
 
Product Number ARP42281_T100
Product Page www.avivasysbio.com/nnmt-antibody-n-terminal-region-arp42281-t100.html
Name NNMT Antibody - N-terminal region (ARP42281_T100)
Protein Size (# AA) 264 amino acids
Molecular Weight 29kDa
NCBI Gene Id 4837
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Nicotinamide N-methyltransferase
Description
Peptide Sequence Synthetic peptide located within the following region: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Roessler,M., (2005) Clin. Cancer Res. 11 (18), 6550-6557
Description of Target N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.
Protein Interactions UBC; BMF; ATF6; APP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NNMT (ARP42281_T100) antibody
Blocking Peptide For anti-NNMT (ARP42281_T100) antibody is Catalog # AAP42281 (Previous Catalog # AAPP24646)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NNMT
Uniprot ID P40261
Protein Name Nicotinamide N-methyltransferase
Publications

Genetic Nicotinamide N-Methyltransferase (Nnmt) Deficiency in Male Mice Improves Insulin Sensitivity in Diet-Induced Obesity but Does Not Affect Glucose Tolerance. Diabetes. 68, 527-542 (2019). 30552109

Nicotinamide N-methyltransferase regulates hepatic nutrient metabolism through Sirt1 protein stabilization. Nat Med. 21, 887-94 (2015). 26168293

Ulanovskaya, O. A., Zuhl, A. M. & Cravatt, B. F. NNMT promotes epigenetic remodeling in cancer by creating a metabolic methylation sink. Nat. Chem. Biol. 9, 300-6 (2013). 23455543

Protein Accession # NP_006160
Purification Protein A purified
Nucleotide Accession # NM_006169
Tested Species Reactivity Human
Gene Symbol NNMT
Predicted Species Reactivity Human, Mouse, Rat, Dog, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 93%; Human: 100%; Mouse: 100%; Pig: 86%; Rat: 100%
Image 1
Liver
Rabbit Anti-NNMT antibody
Catalog Number: ARP42281_T100
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm in hepatocytes
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Image 2
Human Hela
Host: Rabbit
Target Name: NNMT
Sample Tissue: Human Hela
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com