Product Number |
ARP42281_T100 |
Product Page |
www.avivasysbio.com/nnmt-antibody-n-terminal-region-arp42281-t100.html |
Name |
NNMT Antibody - N-terminal region (ARP42281_T100) |
Protein Size (# AA) |
264 amino acids |
Molecular Weight |
29kDa |
NCBI Gene Id |
4837 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Nicotinamide N-methyltransferase |
Description |
|
Peptide Sequence |
Synthetic peptide located within the following region: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Roessler,M., (2005) Clin. Cancer Res. 11 (18), 6550-6557 |
Description of Target |
N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. |
Protein Interactions |
UBC; BMF; ATF6; APP; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NNMT (ARP42281_T100) antibody |
Blocking Peptide |
For anti-NNMT (ARP42281_T100) antibody is Catalog # AAP42281 (Previous Catalog # AAPP24646) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NNMT |
Uniprot ID |
P40261 |
Protein Name |
Nicotinamide N-methyltransferase |
Publications |
Genetic Nicotinamide N-Methyltransferase (Nnmt) Deficiency in Male Mice Improves Insulin Sensitivity in Diet-Induced Obesity but Does Not Affect Glucose Tolerance. Diabetes. 68, 527-542 (2019). 30552109
Nicotinamide N-methyltransferase regulates hepatic nutrient metabolism through Sirt1 protein stabilization. Nat Med. 21, 887-94 (2015). 26168293
Ulanovskaya, O. A., Zuhl, A. M. & Cravatt, B. F. NNMT promotes epigenetic remodeling in cancer by creating a metabolic methylation sink. Nat. Chem. Biol. 9, 300-6 (2013). 23455543 |
Protein Accession # |
NP_006160 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006169 |
Tested Species Reactivity |
Human |
Gene Symbol |
NNMT |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Human: 100%; Mouse: 100%; Pig: 86%; Rat: 100% |
Image 1 | Liver
| Rabbit Anti-NNMT antibody Catalog Number: ARP42281_T100 Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 2.0 sec
|
|
Image 2 | Human Hela
| Host: Rabbit Target Name: NNMT Sample Tissue: Human Hela Antibody Dilution: 1.0ug/ml |
|