SLC6A8 Antibody - N-terminal region (ARP42248_T100)

Data Sheet
 
Product Number ARP42248_T100
Product Page www.avivasysbio.com/slc6a8-antibody-n-terminal-region-arp42248-t100.html
Name SLC6A8 Antibody - N-terminal region (ARP42248_T100)
Protein Size (# AA) 635 amino acids
Molecular Weight 70kDa
NCBI Gene Id 6535
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Solute carrier family 6 (neurotransmitter transporter, creatine), member 8
Alias Symbols CRT, CT1, CRTR, CTR5, CCDS1
Peptide Sequence Synthetic peptide located within the following region: CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Dodd,J.R. (2005) J. Biol. Chem. 280 (38), 32649-32654
Description of Target SLC6A8 is required for the uptake of creatine in muscles and brain.
Protein Interactions UBC; CD59;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SLC6A8 (ARP42248_T100) antibody
Blocking Peptide For anti-SLC6A8 (ARP42248_T100) antibody is Catalog # AAP42248 (Previous Catalog # AAPS12104)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC6A8
Uniprot ID P48029
Protein Name Sodium- and chloride-dependent creatine transporter 1
Sample Type Confirmation

SLC6A8 is strongly supported by BioGPS gene expression data to be expressed in MDA-MB435

Protein Accession # NP_005620
Purification Protein A purified
Nucleotide Accession # NM_005629
Tested Species Reactivity Human
Gene Symbol SLC6A8
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human Muscle
Rabbit Anti-SLC6A8 Antibody
Catalog Number: ARP42248
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human MDA-MB-435s, Human THP-1
Host: Rabbit
Target Name: SLC6A8
Sample Tissue: Human MDA-MB-435s, Human THP-1
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com