Product Number |
ARP42248_T100 |
Product Page |
www.avivasysbio.com/slc6a8-antibody-n-terminal-region-arp42248-t100.html |
Name |
SLC6A8 Antibody - N-terminal region (ARP42248_T100) |
Protein Size (# AA) |
635 amino acids |
Molecular Weight |
70kDa |
NCBI Gene Id |
6535 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Solute carrier family 6 (neurotransmitter transporter, creatine), member 8 |
Alias Symbols |
CRT, CT1, CRTR, CTR5, CCDS1 |
Peptide Sequence |
Synthetic peptide located within the following region: CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Dodd,J.R. (2005) J. Biol. Chem. 280 (38), 32649-32654 |
Description of Target |
SLC6A8 is required for the uptake of creatine in muscles and brain. |
Protein Interactions |
UBC; CD59; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLC6A8 (ARP42248_T100) antibody |
Blocking Peptide |
For anti-SLC6A8 (ARP42248_T100) antibody is Catalog # AAP42248 (Previous Catalog # AAPS12104) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC6A8 |
Uniprot ID |
P48029 |
Protein Name |
Sodium- and chloride-dependent creatine transporter 1 |
Sample Type Confirmation |
SLC6A8 is strongly supported by BioGPS gene expression data to be expressed in MDA-MB435 |
Protein Accession # |
NP_005620 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_005629 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC6A8 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human Muscle
| Rabbit Anti-SLC6A8 Antibody Catalog Number: ARP42248 Paraffin Embedded Tissue: Human Muscle Cellular Data: Skeletal muscle cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 2 | Human MDA-MB-435s, Human THP-1
| Host: Rabbit Target Name: SLC6A8 Sample Tissue: Human MDA-MB-435s, Human THP-1 Antibody Dilution: 1.0ug/ml |
|