IDH3A Antibody - N-terminal region (ARP42237_T100)

• Product Number: ARP42237_T100
• Name: IDH3A Antibody - N-terminal region (ARP42237_T100)
• Protein Size (# AA): 366 amino acids
• Molecular Weight: 40kDa
• Subunit: alpha, mitochondrial
• NCBI Gene Id: 3419
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Isocitrate dehydrogenase 3 (NAD+) alpha
• Description:
  View product citations for IDH3A Antibody - N-terminal region (ARP42237_T100) on CiteAb
• Alias Symbols: RP90
• Peptide Sequence: Synthetic peptide located within the following region: MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Soundar,S., (2003) J. Biol. Chem. 278 (52), 52146-52153
• Description of Target: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. IDH3A is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase.Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase.
• Protein Interactions: HUWE1; SUMO2; STAU1; UBC; MDM2; ADRB2; gag-pol; RAB4A; MBNL1; S100A16; SUCLA2; UQCRFS1P1; SUMO4; EBNA-LP; MYC; TERF2; TERF1; PSMD4; DDA1; DMWD; IDH3B; IDH3G;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-IDH3A (ARP42237_T100) antibody is Catalog # AAP42237 (Previous Catalog # AAPP24660)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IDH3A
• Uniprot ID: P50213
• Protein Name: Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
• Publications:

  Alteration of isocitrate dehydrogenase following acute ischemic injury as a means to improve cellular energetic status in neuroadaptation. CNS Neurol Disord Drug Targets. 12, 849-60 (2013). 23469839

  Lin, C.-C. et al. Loss of the respiratory enzyme citrate synthase directly links the Warburg effect to tumor malignancy. Sci. Rep. 2, 785 (2012). 23139858

• Sample Type Confirmation:

  IDH3A is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_005521
• Purification: Protein A purified
• Nucleotide Accession #: NM_005530
• Tested Species Reactivity: Human
• Gene Symbol: IDH3A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB, IP
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Image 1: 293T, Liver tumor
  
  Host: Rabbit
  Target: IDH3A
  Positive control (+): 293T (2T)
  Negative control (-): Liver tumor (T-LI)
  Antibody concentration: 1ug/ml
• Image 2: HEK293 Whole Cell Lysate
  
  IDH3A was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with ARP42237_T100 with 1:200 dilution. Western blot was performed using ARP42237_T100 at 1/1000 dilution.
  Lane 1: Control IP in HEK293 Whole Cell Lysate.
  Lane 2: IDH3A IP with ARP42237_T100 in HEK293 Whole Cell Lysate.
  Lane 3: Input of HEK293 Whole Cell Lysate.
• Image 3: Human Skeletal muscle
  
  Rabbit Anti-IDH3A Antibody
  Catalog Number: ARP42237
  Paraffin Embedded Tissue: Human Muscle
  Cellular Data: Skeletal muscle cells
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 4: Human HepG2
  
  Host: Rabbit
  Target Name: IDH3A
  Sample Tissue: Human HepG2
  Antibody Dilution: 1.0ug/ml