| Product Number |
ARP42207_P050 |
| Product Page |
www.avivasysbio.com/igfals-antibody-middle-region-arp42207-p050.html |
| Name |
IGFALS Antibody - middle region (ARP42207_P050) |
| Protein Size (# AA) |
605 amino acids |
| Molecular Weight |
63kDa |
| NCBI Gene Id |
3483 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Insulin-like growth factor binding protein, acid labile subunit |
| Alias Symbols |
ALS, ACLSD |
| Peptide Sequence |
Synthetic peptide located within the following region: DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Heath,K.E., (2008) J. Clin. Endocrinol. Metab. 93 (5), 1616-1624 |
| Description of Target |
Adaptor proteins are usually required for transcriptional activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter.TADA3L is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumor suppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. |
| Protein Interactions |
PDCD6; IGF1; IGFBP5; IGFBP3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-IGFALS (ARP42207_P050) antibody |
| Blocking Peptide |
For anti-IGFALS (ARP42207_P050) antibody is Catalog # AAP42207 (Previous Catalog # AAPP24630) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human IGFALS |
| Uniprot ID |
P35858 |
| Protein Name |
Insulin-like growth factor-binding protein complex acid labile subunit |
| Protein Accession # |
NP_004961 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004970 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
IGFALS |
| Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-IGFALS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T |
|
|
