CD8B Antibody - N-terminal region (ARP42204_P050)

• Product Number: ARP42204_P050
• Name: CD8B Antibody - N-terminal region (ARP42204_P050)
• Protein Size (# AA): 246 amino acids
• Molecular Weight: 27kDa
• NCBI Gene Id: 926
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: CD8b molecule
• Alias Symbols: LY3, P37, LEU2, LYT3, CD8B1
• Peptide Sequence: Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Moody,A.M., (2003) J. Biol. Chem. 278 (9), 7240-7246
• Description of Target: The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. CD8B is the CD8 beta chain isoforms.The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified.
• Protein Interactions: ELAVL1; CD8A; CD3D; CD8B; ST3GAL4; LCK;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CD8B (ARP42204_P050) antibody is Catalog # AAP42204 (Previous Catalog # AAPP24627)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CD8B
• Uniprot ID: Q53QL8
• Protein Name: Putative uncharacterized protein CD8B1 EMBL AAY24019.1
• Protein Accession #: NP_742097
• Purification: Affinity Purified
• Nucleotide Accession #: NM_172099
• Tested Species Reactivity: Human
• Gene Symbol: CD8B
• Predicted Species Reactivity: Human, Rat, Dog, Guinea Pig, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rat: 86%
• Image 1: Human Jurkat
  
  WB Suggested Anti-CD8B Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate