| Product Number |
ARP42196_T100 |
| Product Page |
www.avivasysbio.com/itgbl1-antibody-n-terminal-region-arp42196-t100.html |
| Name |
ITGBL1 Antibody - N-terminal region (ARP42196_T100) |
| Protein Size (# AA) |
494 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
9358 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Integrin, beta-like 1 (with EGF-like repeat domains) |
| Alias Symbols |
OSCP, TIED |
| Peptide Sequence |
Synthetic peptide located within the following region: MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Chumakov,I., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (21), 13675-13680 |
| Description of Target |
The function remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ITGBL1 (ARP42196_T100) antibody |
| Blocking Peptide |
For anti-ITGBL1 (ARP42196_T100) antibody is Catalog # AAP42196 (Previous Catalog # AAPP24620) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ITGBL1 |
| Uniprot ID |
O95965 |
| Protein Name |
Integrin beta-like protein 1 |
| Protein Accession # |
NP_004782 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_004791 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ITGBL1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 80%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ITGBL1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
|
