Product Number |
ARP42158_P050 |
Product Page |
www.avivasysbio.com/ces2-antibody-c-terminal-region-arp42158-p050.html |
Name |
CES2 Antibody - C-terminal region (ARP42158_P050) |
Protein Size (# AA) |
623 amino acids |
Molecular Weight |
69kDa |
NCBI Gene Id |
8824 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Carboxylesterase 2 |
Alias Symbols |
iCE, CE-2, PCE-2, CES2A1 |
Peptide Sequence |
Synthetic peptide located within the following region: HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kimura,K., (2006) Genome Res. 16 (1), 55-65 |
Description of Target |
Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system.Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CES2 (ARP42158_P050) antibody |
Blocking Peptide |
For anti-CES2 (ARP42158_P050) antibody is Catalog # AAP42158 (Previous Catalog # AAPS11907) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CES2 |
Uniprot ID |
O00748 |
Protein Name |
Cocaine esterase |
Sample Type Confirmation |
CES2 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_003860 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003869 |
Tested Species Reactivity |
Human |
Gene Symbol |
CES2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Dog: 83%; Guinea Pig: 83%; Human: 100%; Mouse: 83%; Rat: 83% |
Image 1 | Human HepG2
| WB Suggested Anti-CES2 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysateCES2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells |
|
Image 2 | Human heart
| WB Suggested Anti-CES2 antibody Titration: 1 ug/mL Sample Type: Human heart |
|
Image 3 | Kidney
| Rabbit Anti-CES2 antibody Catalog Number: ARP42158 Formalin Fixed Paraffin Embedded Tissue: Human Adult Kidney Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 2.0 sec
|
|
Image 4 | heart
| Rabbit Anti-CES2 Antibody Catalog Number: ARP42158_P050 Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 2.0 sec Protocol located in Reviews and Data. |
|
Image 5 | Human Pineal Tissue
| Rabbit Anti-CES2 Antibody Catalog Number: ARP42158_P050 Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in pinealocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
|
|