CES2 Antibody - C-terminal region (ARP42158_P050)

• Product Number: ARP42158_P050
• Name: CES2 Antibody - C-terminal region (ARP42158_P050)
• Protein Size (# AA): 623 amino acids
• Molecular Weight: 69kDa
• NCBI Gene Id: 8824
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Carboxylesterase 2
• Alias Symbols: iCE, CE-2, PCE-2, CES2A1
• Peptide Sequence: Synthetic peptide located within the following region: HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65
• Description of Target: Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system.Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CES2 (ARP42158_P050) antibody is Catalog # AAP42158 (Previous Catalog # AAPS11907)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CES2
• Uniprot ID: O00748
• Protein Name: Cocaine esterase
• Sample Type Confirmation:

  CES2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_003860
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003869
• Tested Species Reactivity: Human
• Gene Symbol: CES2
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Dog: 83%; Guinea Pig: 83%; Human: 100%; Mouse: 83%; Rat: 83%
• Image 1: Human HepG2
  
  WB Suggested Anti-CES2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysateCES2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
• Image 2: Human heart
  
  WB Suggested Anti-CES2 antibody Titration: 1 ug/mL
  Sample Type: Human heart
• Image 3: Kidney
  
  Rabbit Anti-CES2 antibody
  Catalog Number: ARP42158
  Formalin Fixed Paraffin Embedded Tissue: Human Adult Kidney
  Observed Staining: Cytoplasm in hepatocytes
  Primary Antibody Concentration: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  
• Image 4: heart
  
  Rabbit Anti-CES2 Antibody
  Catalog Number: ARP42158_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
  Observed Staining: Cytoplasmic
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy2/3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  Protocol located in Reviews and Data.
• Image 5: Human Pineal Tissue
  
  Rabbit Anti-CES2 Antibody
  Catalog Number: ARP42158_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
  Observed Staining: Cytoplasmic in pinealocytes
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec