| Product Number |
ARP42122_P050 |
| Product Page |
www.avivasysbio.com/tst-antibody-middle-region-arp42122-p050.html |
| Name |
TST Antibody - middle region (ARP42122_P050) |
| Protein Size (# AA) |
297 amino acids |
| Molecular Weight |
33 kDa |
| NCBI Gene Id |
7263 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Thiosulfate sulfurtransferase (rhodanese) |
| Alias Symbols |
RDS |
| Peptide Sequence |
Synthetic peptide located within the following region: GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Matthies,A., (2005) Biochemistry 44 (21), 7912-7920 |
| Description of Target |
TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin. |
| Protein Interactions |
NEDD8; S100A16; HPDL; SEPT11; SEC22B; SLC9A3R2; AIFM1; UBE2M; SNRPA; PSMD7; PSMB2; UBC; ND1; PRSS1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-TST (ARP42122_P050) antibody |
| Additional Information |
IHC Information: Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE) |
| Blocking Peptide |
For anti-TST (ARP42122_P050) antibody is Catalog # AAP42122 (Previous Catalog # AAPS11607) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TST |
| Uniprot ID |
Q16762 |
| Protein Name |
Thiosulfate sulfurtransferase |
| Protein Accession # |
NP_003303 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003312 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TST |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Small Intestine
 | Anti-TST antibody IHC staining of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|
| Image 2 | Human Liver
 | Anti-TST antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|
| Image 3 | Human Lung
 | Rabbit Anti-TST Antibody
Catalog Number: ARP42122
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 4 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein may be modified by acetylation and succinylation.
|
|
