TGM3 Antibody - N-terminal region (ARP42111_P050)

Data Sheet
 
Product Number ARP42111_P050
Product Page www.avivasysbio.com/tgm3-antibody-n-terminal-region-arp42111-p050.html
Name TGM3 Antibody - N-terminal region (ARP42111_P050)
Protein Size (# AA) 693 amino acids
Molecular Weight 77kDa
NCBI Gene Id 7053
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transglutaminase 3 (E polypeptide, protein-glutamine-gamma-glutamyltransferase)
Alias Symbols TGE, UHS2
Peptide Sequence Synthetic peptide located within the following region: MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zocchi,L., (2007) J. Invest. Dermatol. 127 (7), 1791-1794
Description of Target Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites
Protein Interactions WWOX; ZBTB1; PARK2; LIG4; SIRT7; UBC; UCHL5; PRKAB1; USP32P2; USP53; CALML5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TGM3 (ARP42111_P050) antibody
Blocking Peptide For anti-TGM3 (ARP42111_P050) antibody is Catalog # AAP42111 (Previous Catalog # AAPP24590)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TGM3
Uniprot ID Q08188
Protein Name Protein-glutamine gamma-glutamyltransferase E
Protein Accession # NP_003236
Purification Affinity Purified
Nucleotide Accession # NM_003245
Tested Species Reactivity Human
Gene Symbol TGM3
Predicted Species Reactivity Human, Mouse, Rat, Dog, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 86%; Human: 100%; Mouse: 86%; Rabbit: 85%; Rat: 86%
Image 1
Human PANC1
WB Suggested Anti-TGM3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com