| Product Number |
ARP42101_P050 |
| Product Page |
www.avivasysbio.com/sqle-antibody-c-terminal-region-arp42101-p050.html |
| Name |
SQLE Antibody - C-terminal region (ARP42101_P050) |
| Protein Size (# AA) |
574 amino acids |
| Molecular Weight |
64kDa |
| NCBI Gene Id |
6713 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Squalene epoxidase |
| Alias Symbols |
FLJ30795, ERG1 |
| Peptide Sequence |
Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway. |
| Protein Interactions |
MARCH6; UBC; ALDOC; ZNF641; CREB3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SQLE (ARP42101_P050) antibody |
| Additional Information |
IHC Information: 721_B cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-SQLE (ARP42101_P050) antibody is Catalog # AAP42101 (Previous Catalog # AAPP24580) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SQLE |
| Uniprot ID |
Q14534 |
| Protein Name |
Squalene monooxygenase |
| Sample Type Confirmation |
SQLE is strongly supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
BAA11209 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003129 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SQLE |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 93%; Sheep: 100%; Zebrafish: 86% |
| Image 1 | Human Bronchial Epithelial Tissue
 | Rabbit Anti-SQLE Antibody
Catalog Number: ARP42101_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
|
|
| Image 2 | Human MCF7
 | Host: Rabbit
Target Name: SQLE
Sample Tissue: Human MCF7
Antibody Dilution: 1.0ug/ml |
|
| Image 3 | Human Brain
 | Rabbit Anti-SQLE Antibody
Catalog Number: ARP42101
Paraffin Embedded Tissue: Human neural cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 4 | Human Liver
 | Rabbit Anti-SQLE Antibody
Catalog Number: ARP42101
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hepatocytes
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
