SEMG1 Antibody - C-terminal region (ARP42090_T100)

• Product Number: ARP42090_T100
• Name: SEMG1 Antibody - C-terminal region (ARP42090_T100)
• Protein Size (# AA): 462 amino acids
• Molecular Weight: 51kDa
• NCBI Gene Id: 6406
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Semenogelin I
• Alias Symbols: SGI, SEMG, CT103, dJ172H20.2
• Peptide Sequence: Synthetic peptide located within the following region: GENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hienonen,T., (2005) Cancer Res. 65 (11), 4607-4613
• Description of Target: SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely.The protein encoded by this gene is the predominant protein in semen. The encoded secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely. Two transcript variants encoding different isoforms have been found for this gene.
• Protein Interactions: FBXW4; SUMO2; PIK3R2; UBQLN4; CDK2; UBC; TGM1; SEMG2; PRKCA; KLK3; KLK2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SEMG1 (ARP42090_T100) antibody is Catalog # AAP42090 (Previous Catalog # AAPP24569)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SEMG1
• Uniprot ID: P04279
• Protein Name: Semenogelin-1
• Protein Accession #: NP_002998
• Purification: Protein A purified
• Nucleotide Accession #: NM_003007
• Tested Species Reactivity: Human
• Gene Symbol: SEMG1
• Predicted Species Reactivity: Human, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 77%
• Image 1: Human Jurkat
  
  WB Suggested Anti-SEMG1 Antibody Titration: 1.25ug/ml
  Positive Control: Jurkat cell lysate