| Product Number |
ARP42084_T100 |
| Product Page |
www.avivasysbio.com/s100a3-antibody-n-terminal-region-arp42084-t100.html |
| Name |
S100A3 Antibody - N-terminal region (ARP42084_T100) |
| Protein Size (# AA) |
101 amino acids |
| Molecular Weight |
11kDa |
| NCBI Gene Id |
6274 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
S100 calcium binding protein A3 |
| Alias Symbols |
S100E |
| Peptide Sequence |
Synthetic peptide located within the following region: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kizawa,K., (2002) Biochem. Biophys. Res. Commun. 299 (5), 857-862 |
| Description of Target |
S100A3 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown. |
| Protein Interactions |
S100A3; DLG3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-S100A3 (ARP42084_T100) antibody |
| Blocking Peptide |
For anti-S100A3 (ARP42084_T100) antibody is Catalog # AAP42084 (Previous Catalog # AAPP24563) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human S100A3 |
| Uniprot ID |
P33764 |
| Protein Name |
Protein S100-A3 |
| Sample Type Confirmation |
S100A3 is supported by BioGPS gene expression data to be expressed in OVCAR3 |
| Protein Accession # |
NP_002951 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002960 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
S100A3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 82%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human Skin
 | Rabbit Anti-S100A3 Antibody
Catalog Number: ARP42084
Paraffin Embedded Tissue: Human Skin
Cellular Data: Squamous epithelial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 2 | Human OVCAR-3
 | WB Suggested Anti-S100A3 Antibody Titration: 5.0ug/ml
Positive Control: OVCAR-3 cell lysateS100A3 is supported by BioGPS gene expression data to be expressed in OVCAR3 |
|
| Image 3 | HepG2, THP-1
 | Host: Rabbit
Target: S100A3
Positive control (+): HepG2 (HG)
Negative control (-): THP-1 (N30)
Antibody concentration: 3ug/ml |
|
