| Product Number |
ARP42079_P050 |
| Product Page |
www.avivasysbio.com/rasa1-antibody-c-terminal-region-arp42079-p050.html |
| Name |
Rasa1 Antibody - C-terminal region (ARP42079_P050) |
| Protein Size (# AA) |
813 amino acids |
| Molecular Weight |
94kDa |
| NCBI Gene Id |
218397 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
RAS p21 protein activator 1 |
| Alias Symbols |
G, Gap, Rasa, p120-, RasGAP |
| Peptide Sequence |
Synthetic peptide located within the following region: SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
Khdrbs1; Dok1; Dok2; Abl1; Arhgap35; Ephb2; Arhgap5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Rasa1 (ARP42079_P050) antibody |
| Blocking Peptide |
For anti-Rasa1 (ARP42079_P050) antibody is Catalog # AAP42079 (Previous Catalog # AAPP24558) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q91YX7 |
| Protein Name |
RAS p21 protein activator 1 EMBL AAH13637.1 |
| Protein Accession # |
NP_663427 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_145452 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Rasa1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Mouse Brain
 | WB Suggested Anti-Rasa1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Brain |
|
|
