| Product Number |
ARP42067_T100 |
| Product Page |
www.avivasysbio.com/psg5-antibody-n-terminal-region-arp42067-t100.html |
| Name |
PSG5 Antibody - N-terminal region (ARP42067_T100) |
| Protein Size (# AA) |
335 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
5673 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Pregnancy specific beta-1-glycoprotein 5 |
| Alias Symbols |
PSG, FL-NCA-3 |
| Peptide Sequence |
Synthetic peptide located within the following region: QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Blanchon,L., (2006) Biochem. Biophys. Res. Commun. 343 (3), 745-753 |
| Description of Target |
The pregnancy-specific beta 1 glycoprotein (PSG) is a group of heterogeneous proteins produced in large amounts by the human syncytiotrophoblast. They belong to the carcinoembryonic antigen (CEA) family. The function of PSG5 remains unknown. |
| Protein Interactions |
TIE1; PRPF40A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PSG5 (ARP42067_T100) antibody |
| Blocking Peptide |
For anti-PSG5 (ARP42067_T100) antibody is Catalog # AAP42067 (Previous Catalog # AAPP24546) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PSG5 |
| Uniprot ID |
Q15238 |
| Protein Name |
Pregnancy-specific beta-1-glycoprotein 5 |
| Protein Accession # |
NP_002772 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002781 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PSG5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 77%; Horse: 77%; Human: 100%; Mouse: 85%; Rat: 85% |
| Image 1 | Human Placenta
 | WB Suggested Anti-PSG5 Antibody Titration: 2.5ug/ml
Positive Control: Human Placenta |
|
|
