| Product Number |
ARP42057_T100 |
| Product Page |
www.avivasysbio.com/plin-antibody-n-terminal-region-arp42057-t100.html |
| Name |
PLIN Antibody - N-terminal region (ARP42057_T100) |
| Protein Size (# AA) |
522 amino acids |
| Molecular Weight |
57kDa |
| NCBI Gene Id |
5346 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Perilipin 1 |
| Alias Symbols |
PERI, PLIN, FPLD4 |
| Peptide Sequence |
Synthetic peptide located within the following region: STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Moore,H.P., (2005) J. Biol. Chem. 280 (52), 43109-43120 |
| Description of Target |
PLIN coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis.The protein encoded by this gene coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The encoded protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis. |
| Protein Interactions |
ABHD5; PLIN1; LIPE; PRKACA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PLIN1 (ARP42057_T100) antibody |
| Blocking Peptide |
For anti-PLIN1 (ARP42057_T100) antibody is Catalog # AAP42057 (Previous Catalog # AAPP24536) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PLIN |
| Uniprot ID |
O60240 |
| Protein Name |
Perilipin-1 |
| Protein Accession # |
NP_002657 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002666 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PLIN1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 83% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-PLIN Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate |
|
|
