| Product Number |
ARP42031_T100 |
| Product Page |
www.avivasysbio.com/krt13-antibody-c-terminal-region-arp42031-t100.html |
| Name |
KRT13 Antibody - C-terminal region (ARP42031_T100) |
| Protein Size (# AA) |
420 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
3860 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Keratin 13 |
| Alias Symbols |
K13, CK13, WSN2 |
| Peptide Sequence |
Synthetic peptide located within the following region: EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Olson,G.E., (2002) Biol. Reprod. 66 (4), 1006-1015 |
| Description of Target |
KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia.The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in this gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been described. |
| Protein Interactions |
FAM127C; GOLGA8EP; KRT79; TRIM42; KRT6C; CEP57L1; TXLNA; PPP1R18; ALS2CR11; KLC3; C1orf216; CCDC101; KRT71; IFT20; KLC4; FBF1; ANKRD36BP1; LSM2; EXOSC5; C1orf109; CCHCR1; KRT20; AMOTL2; ABI3; BLOC1S6; FARS2; ABI2; CEP57; EIF4E2; TSG101; TMSB4X; PSMB2; PSM |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KRT13 (ARP42031_T100) antibody |
| Blocking Peptide |
For anti-KRT13 (ARP42031_T100) antibody is Catalog # AAP42031 (Previous Catalog # AAPP24512) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human KRT13 |
| Uniprot ID |
P13646 |
| Protein Name |
Keratin, type I cytoskeletal 13 |
| Protein Accession # |
NP_002265 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002274 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KRT13 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 85% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-KRT13 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human Lung
 | Rabbit Anti-KRT13 Antibody
Catalog Number: ARP42031
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 3 | Hela, Human lung
 | Host: Rabbit
Target: KRT13
Positive control (+): Hela (HL)
Negative control (-): Human lung (LU)
Antibody concentration: 1ug/ml |
|
