GCG Antibody - N-terminal region (ARP42010_T100)

• Product Number: ARP42010_T100
• Name: GCG Antibody - N-terminal region (ARP42010_T100)
• Protein Size (# AA): 180 amino acids
• Molecular Weight: 20kDa
• NCBI Gene Id: 2641
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Glucagon
• Alias Symbols: GLP1, GLP2, GRPP, GLP-1
• Peptide Sequence: Synthetic peptide located within the following region: LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Meier,J.J., (2006) Gastroenterology 130 (1), 44-54
• Description of Target: GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
• Protein Interactions: ARRB2; GLP1R; GLP2R; MEP1B; MEP1A; GCGR; CTSL; CPE;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GCG (ARP42010_T100) antibody is Catalog # AAP42010 (Previous Catalog # AAPS11503)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GCG
• Uniprot ID: P01275
• Protein Name: Glucagon
• Protein Accession #: NP_002045
• Purification: Protein A purified
• Nucleotide Accession #: NM_002054
• Tested Species Reactivity: Human
• Gene Symbol: GCG
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 75%
• Image 1: Human Jurkat
  
  WB Suggested Anti-GCG Antibody Titration: 1.25ug/ml
  Positive Control: Jurkat cell lysate