CST4 Antibody - N-terminal region (ARP41986_T100)

• Product Number: ARP41986_T100
• Name: CST4 Antibody - N-terminal region (ARP41986_T100)
• Protein Size (# AA): 141 amino acids
• Molecular Weight: 16kDa
• NCBI Gene Id: 1472
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Cystatin S
• Alias Symbols: MGC71923
• Peptide Sequence: Synthetic peptide located within the following region: MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Dickinson,D.P., (2002) DNA Cell Biol. 21 (1), 47-65
• Description of Target: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function.The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a type 2 salivary cysteine peptidase inhibitor. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CST4 (ARP41986_T100) antibody is Catalog # AAP41986 (Previous Catalog # AAPS11303)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CST4
• Uniprot ID: P01036
• Protein Name: Cystatin-S
• Sample Type Confirmation:

  CST4 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_001890
• Purification: Protein A purified
• Nucleotide Accession #: NM_001899
• Tested Species Reactivity: Human
• Gene Symbol: CST4
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-CST4 Antibody Titration: 1.25ug/ml
  Positive Control: HepG2 cell lysateCST4 is supported by BioGPS gene expression data to be expressed in HepG2