Product Number |
ARP41970_P050 |
Product Page |
www.avivasysbio.com/bdnf-antibody-middle-region-arp41970-p050.html |
Name |
BDNF Antibody - middle region (ARP41970_P050) |
Protein Size (# AA) |
247 amino acids |
Molecular Weight |
28 kDa |
NCBI Gene Id |
627 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Brain-derived neurotrophic factor |
Description |
|
Alias Symbols |
ANON2, BULN2 |
Peptide Sequence |
Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Hashimoto,R., (2008) Neurosci. Res. 61 (4), 360-367 |
Description of Target |
BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined. |
Protein Interactions |
UBC; AGO3; INPP5K; F11R; JUNB; APP; ELAVL1; Ntrk2; CADPS2; MBTPS1; SORT1; NOS3; NTF4; NTF3; ESR1; NCAM1; CPE; BDNF |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-BDNF (ARP41970_P050) antibody |
Blocking Peptide |
For anti-BDNF (ARP41970_P050) antibody is Catalog # AAP41970 (Previous Catalog # AAPS11111) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human BDNF |
Uniprot ID |
P23560 |
Protein Name |
Brain-derived neurotrophic factor |
Publications |
Horibe, I. et al. Induction of melanogenesis by 4â-O-methylated flavonoids in B16F10 melanoma cells. J. Nat. Med. 67, 705-10 (2013). 23242310
McCarthy, D. M. et al. Cocaine alters BDNF expression and neuronal migration in the embryonic mouse forebrain. J. Neurosci. 31, 13400-11 (2011). 21940433
Prenatal Cocaine Exposure Alters BDNF-TrkB Signaling in the Embryonic and Adult Brain. Dev. Neurosci. 38, 365-374 (2016). 28132054
Reversal Learning Deficits Associated with Increased Frontal Cortical Brain-Derived Neurotrophic Factor Tyrosine Kinase B Signaling in a Prenatal Cocaine Exposure Mouse Model. Dev. Neurosci. 38, 354-364 (2016). 27951531
Sex differences and estrogen regulation of BDNF gene expression, but not propeptide content, in the developing hippocampus. J. Neurosci. Res. 95, 345-354 (2017). 27870444
The Bdnf and Npas4 genes are targets of HDAC3-mediated transcriptional repression. BMC Neurosci. 20, 65 (2019). 31883511
TrkB/BDNF signalling patterns the sympathetic nervous system. Nat Commun. 6, 8281 (2015). 26404565 |
Protein Accession # |
NP_001700 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001709 |
Tested Species Reactivity |
Human, Mouse, Monkey |
Gene Symbol |
BDNF |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Rhesus macaque spinal cord
| Sample Type: Rhesus macaque spinal cordPrimary Antibody Dilution: 1:300Secondary Antibody: Donkey anti Rabbit 488Secondary Antibody Dilution: 1:500Color/Signal Descriptions: Green: BDNFGene Name: BDNFSubmitted by: Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706 |
|
Image 2 | Ventral horn region of mouse spinal cord
| Sample Type: Ventral horn region of mouse spinal cordPrimary Antibody Dilution: 1:200Secondary Antibody: Donkey anti-rabbit CY2Secondary Antibody Dilution: 1:500Color/Signal Descriptions: Green:BDNFGene Name: BDNFSubmitted by: Anonymous
|
|
Image 3 | Mouse Brain
| Host: Mouse Target Name: BDNF Sample Tissue: Mouse Brain Antibody Dilution: 1ug/ml |
|
Image 4 | Mouse Pancreas
| Host: Mouse Target Name: BDNF Sample Tissue: Mouse Pancreas Antibody Dilution: 1ug/ml |
|
Image 5 | Human Ovary Tumor
| Host: Rabbit Target Name: BDNF Sample Tissue: Human Ovary Tumor Antibody Dilution: 1ug/ml |
|
Image 6 |
| Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
|
|