Product Number |
ARP41962_T100 |
Product Page |
www.avivasysbio.com/apcs-antibody-n-terminal-region-arp41962-t100.html |
Name |
APCS Antibody - N-terminal region (ARP41962_T100) |
Protein Size (# AA) |
223 amino acids |
Molecular Weight |
25kDa |
NCBI Gene Id |
325 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Amyloid P component, serum |
Alias Symbols |
SAP, PTX2, HEL-S-92n |
Peptide Sequence |
Synthetic peptide located within the following region: NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Veerhuis,R., Neurobiol. Dis. 19 (1-2), 273-282 (2005) |
Description of Target |
APCS is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo.The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. This gene has multiple polyadenylation sites. |
Protein Interactions |
COPS5; GK; HES1; GRB2; GOT2; FCGR3B; FCGR2B; CALU; TG; LAMA1; FCGR1A; FCGR3A; FN1; CRP; C4BPA; C1QA; COL4A1; APCS; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-APCS (ARP41962_T100) antibody |
Blocking Peptide |
For anti-APCS (ARP41962_T100) antibody is Catalog # AAP41962 (Previous Catalog # AAPS11103) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human APCS |
Uniprot ID |
P02743 |
Protein Name |
Serum amyloid P-component |
Protein Accession # |
NP_001630 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001639 |
Tested Species Reactivity |
Human |
Gene Symbol |
APCS |
Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 86%; Human: 100%; Mouse: 77%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-APCS Antibody Titration: 1.25ug/ml Positive Control: Jurkat cell lysate |
|
Image 2 | Human Intestine
| Rabbit Anti-APCS Antibody Catalog Number: ARP41962 Paraffin Embedded Tissue: Human Intestine Cellular Data: Epithelial cells of intestinal villas Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|