MPPED2 antibody - N-terminal region (ARP41957_P050)
Data Sheet
 
Product Number ARP41957_P050
Product Page www.avivasysbio.com/mpped2-antibody-n-terminal-region-arp41957-p050.html
Product Name MPPED2 antibody - N-terminal region (ARP41957_P050)
Size 100 ul
Gene Symbol MPPED2
Alias Symbols 239FB, C11orf8, D11S302E, FAM1B, Hs.46638, dJ1024C24.1, dJ873F21.1
Protein Size (# AA) 294 amino acids
Molecular Weight 33kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 744
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Metallophosphoesterase domain containing 2
Description This is a rabbit polyclonal antibody against MPPED2. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: RFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHT
Target Reference Schwartz,F. (1997) Gene 194 (1), 57-62
Description of Target The specific function of MPPED2 is not yet known.
Protein Interactions FAM72A; CAGE1; VAC14; TRIP13; RXRG;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-MPPED2 (ARP41957_P050) antibody is Catalog # AAP41957 (Previous Catalog # AAPP24493)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MPPED2
Complete computational species homology data Anti-MPPED2 (ARP41957_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MPPED2.
Swissprot Id Q15777
Protein Name Metallophosphoesterase MPPED2
Protein Accession # NP_001575
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MPPED2.
Nucleotide Accession # NM_001584
Replacement Item This antibody may replace item sc-102027 from Santa Cruz Biotechnology.
Conjugation Options

ARP41957_P050-FITC Conjugated

ARP41957_P050-HRP Conjugated

ARP41957_P050-Biotin Conjugated

CB Replacement sc-102027; sc-134391
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Transfected 293T
WB Suggested Anti-MPPED2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com