IGSF1 Antibody - N-terminal region (ARP41953_T100)

Data Sheet
 
Product Number ARP41953_T100
Product Page www.avivasysbio.com/igsf1-antibody-n-terminal-region-arp41953-t100.html
Name IGSF1 Antibody - N-terminal region (ARP41953_T100)
Protein Size (# AA) 242 amino acids
Molecular Weight 27kDa
NCBI Gene Id 3547
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Immunoglobulin superfamily, member 1
Alias Symbols CHTE, p120, IGCD1, IGDC1, INHBP, PGSF2
Peptide Sequence Synthetic peptide located within the following region: LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tanaka,S., (2002) J. Mol. Endocrinol. 28 (1), 33-44
Description of Target Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.[supplied by OMIM].
Protein Interactions RANBP10; HECTD1; INHBB; INHBA; IGSF1; BMPR1B; BMPR1A; ACVRL1; ACVR2B; ACVR2A; ACVR1B; ACVR1; IGF1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-IGSF1 (ARP41953_T100) antibody
Blocking Peptide For anti-IGSF1 (ARP41953_T100) antibody is Catalog # AAP41953 (Previous Catalog # AAPP24489)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human IGSF1
Uniprot ID Q8N6C5
Protein Name Immunoglobulin superfamily member 1
Sample Type Confirmation

IGSF1 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_991402
Purification Protein A purified
Nucleotide Accession # NM_205833
Tested Species Reactivity Human
Gene Symbol IGSF1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 86%; Sheep: 93%
Image 1
Human Kidney
Rabbit Anti-IGSF1 Antibody
Catalog Number: ARP41953
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human HepG2
WB Suggested Anti-IGSF1 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysateIGSF1 is supported by BioGPS gene expression data to be expressed in HepG2
Image 3
293T, Human liver
Host: Rabbit
Target: IGSF1
Positive control (+): 293T (2T)
Negative control (-): Human liver (LI)
Antibody concentration: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com