DHODH Antibody - C-terminal region (ARP41942_P050)

Data Sheet
 
Product Number ARP41942_P050
Product Page www.avivasysbio.com/dhodh-antibody-c-terminal-region-arp41942-p050.html
Name DHODH Antibody - C-terminal region (ARP41942_P050)
Protein Size (# AA) 395 amino acids
Molecular Weight 43kDa
NCBI Gene Id 1723
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Dihydroorotate dehydrogenase (quinone)
Alias Symbols URA1, POADS, DHOdehase
Peptide Sequence Synthetic peptide located within the following region: GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Description of Target DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Interactions UBC; TMED10; MT2A; FKBP8; SSBP1; SDHA; PLP2; OGDH; NDUFS8; HNRNPM; ILF3; CYC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DHODH (ARP41942_P050) antibody
Blocking Peptide For anti-DHODH (ARP41942_P050) antibody is Catalog # AAP41942 (Previous Catalog # AAPP24479)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DHODH
Uniprot ID Q02127
Protein Name Dihydroorotate dehydrogenase (quinone), mitochondrial
Sample Type Confirmation

DHODH is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_001352
Purification Affinity Purified
Nucleotide Accession # NM_001361
Tested Species Reactivity Human
Gene Symbol DHODH
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 79%
Image 1
Human Jurkat
WB Suggested Anti-DHODH Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateDHODH is supported by BioGPS gene expression data to be expressed in Jurkat
Image 2
Human Liver Tissue
DHODH antibody - C-terminal region (ARP41942_P050)
Catalog Number: ARP41942_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in hepatocytes
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com