Product Number |
ARP41942_P050 |
Product Page |
www.avivasysbio.com/dhodh-antibody-c-terminal-region-arp41942-p050.html |
Name |
DHODH Antibody - C-terminal region (ARP41942_P050) |
Protein Size (# AA) |
395 amino acids |
Molecular Weight |
43kDa |
NCBI Gene Id |
1723 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Dihydroorotate dehydrogenase (quinone) |
Alias Symbols |
URA1, POADS, DHOdehase |
Peptide Sequence |
Synthetic peptide located within the following region: GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kimura,K., (2006) Genome Res. 16 (1), 55-65 |
Description of Target |
DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Protein Interactions |
UBC; TMED10; MT2A; FKBP8; SSBP1; SDHA; PLP2; OGDH; NDUFS8; HNRNPM; ILF3; CYC1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DHODH (ARP41942_P050) antibody |
Blocking Peptide |
For anti-DHODH (ARP41942_P050) antibody is Catalog # AAP41942 (Previous Catalog # AAPP24479) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DHODH |
Uniprot ID |
Q02127 |
Protein Name |
Dihydroorotate dehydrogenase (quinone), mitochondrial |
Sample Type Confirmation |
DHODH is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_001352 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001361 |
Tested Species Reactivity |
Human |
Gene Symbol |
DHODH |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 79% |
Image 1 | Human Jurkat
| WB Suggested Anti-DHODH Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysateDHODH is supported by BioGPS gene expression data to be expressed in Jurkat |
|
Image 2 | Human Liver Tissue
| DHODH antibody - C-terminal region (ARP41942_P050)
Catalog Number: ARP41942_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in hepatocytes
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|