CHGA Antibody - C-terminal region (ARP41931_P050)

• Product Number: ARP41931_P050
• Name: CHGA Antibody - C-terminal region (ARP41931_P050)
• Protein Size (# AA): 457 amino acids
• Molecular Weight: 51 kDa
• NCBI Gene Id: 1113
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chromogranin A (parathyroid secretory protein 1)
• Alias Symbols: CGA
• Peptide Sequence: Synthetic peptide located within the following region: DSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Leibovitch,I., (2006) Harefuah 145 (1), 25-29
• Description of Target: CHGA is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. Its gene?s product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown.The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown.The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown.
• Protein Interactions: PARK2; UBC; CDC37; PFDN1; NEK2; SCG3; PLG;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-CHGA (ARP41931_P050) antibody is Catalog # AAP41931 (Previous Catalog # AAPP24468)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CHGA
• Uniprot ID: P10645
• Protein Name: Chromogranin-A
• Protein Accession #: NP_001266
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001275
• Tested Species Reactivity: Human
• Gene Symbol: CHGA
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: 25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Isoforms containing the peptide sequence are present at ~106 kDa and at ~77 kDa.
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Isoforms containing the peptide sequence are present at ~106 kDa and at ~77 kDa.