CD40 Antibody - N-terminal region (ARP41929_P050)

• Product Number: ARP41929_P050
• Name: CD40 Antibody - N-terminal region (ARP41929_P050)
• Protein Size (# AA): 277 amino acids
• Molecular Weight: 31 kDa
• NCBI Gene Id: 958
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: CD40 molecule, TNF receptor superfamily member 5
• Alias Symbols: p50, Bp50, CDW40, TNFRSF5
• Peptide Sequence: Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: von (2006) Blood 107 (7), 2786-2789
• Description of Target: CD40 is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
• Protein Interactions: TRAF2; TRAF3; PIK3R1; CD40LG; BAG3; Otud7b; Birc3; IL4R; TRAF6; TRAF5; TRAF3IP2; MAP3K8; TRAF4; TRAF1; PIK3CA; CBL; BIRC2; CDC40; TANK; HSPA4; NSMAF; XRCC5; HSPA8; TDP2; RIPK2; CAV1; JAK3; XRCC6; MS4A1; SUMO1; SLC30A7; RNF219; UGGT1; ERP44; NCOA6; USP15;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CD40 (ARP41929_P050) antibody is Catalog # AAP41929 (Previous Catalog # AAPP24466)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CD40
• Uniprot ID: P25942
• Protein Name: Tumor necrosis factor receptor superfamily member 5
• Sample Type Confirmation:

  CD40 is strongly supported by BioGPS gene expression data to be expressed in Raji

• Protein Accession #: NP_001241
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001250
• Tested Species Reactivity: Human
• Gene Symbol: CD40
• Predicted Species Reactivity: Human, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rabbit: 79%
• Image 1: Human Raji
  
  WB Suggested Anti-CD40 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Raji cell lysateCD40 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells
• Image 2:
  
  25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.