| Product Number |
ARP41902_P050 |
| Product Page |
www.avivasysbio.com/c9orf127-antibody-c-terminal-region-arp41902-p050.html |
| Name |
C9orf127 Antibody - C-terminal region (ARP41902_P050) |
| Protein Size (# AA) |
472 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
51754 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transmembrane protein 8B |
| Alias Symbols |
NAG5, NGX6, FP588, NAG-5, NGX6a, C9orf127, LINC00950 |
| Peptide Sequence |
Synthetic peptide located within the following region: CYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The down-regulation of C9orf127 may be closely associated with tumorigenesis and metastasis of colorectal carcinoma. However, it may not contribute to the development and progression of gastric carcinoma. |
| Protein Interactions |
ATXN1L; EZR; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TMEM8B (ARP41902_P050) antibody |
| Blocking Peptide |
For anti-TMEM8B (ARP41902_P050) antibody is Catalog # AAP41902 (Previous Catalog # AAPP24439) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human C9orf127 |
| Uniprot ID |
Q5TCW5 |
| Protein Name |
Transmembrane protein 8B |
| Protein Accession # |
NP_001036054 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001042589 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TMEM8B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-C9orf127 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
|
