| Product Number |
ARP41889_P050 |
| Product Page |
www.avivasysbio.com/alas2-antibody-c-terminal-region-arp41889-p050.html |
| Name |
ALAS2 Antibody - C-terminal region (ARP41889_P050) |
| Protein Size (# AA) |
550 amino acids |
| Molecular Weight |
60kDa |
| NCBI Gene Id |
212 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Aminolevulinate, delta-, synthase 2 |
| Alias Symbols |
ASB, ANH1, XLSA, ALASE, XLDPP, XLEPP, ALAS-E, SIDBA1 |
| Peptide Sequence |
Synthetic peptide located within the following region: VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Lee,P.L., (2006) Blood Cells Mol. Dis. 36 (2), 292-297 |
| Description of Target |
ALAS2 specifies an erythroid-specific mitochondrially located enzyme. It catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia.The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Protein Interactions |
BANP; GRB2; SUCLA2; RABGGTB; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ALAS2 (ARP41889_P050) antibody |
| Blocking Peptide |
For anti-ALAS2 (ARP41889_P050) antibody is Catalog # AAP41889 (Previous Catalog # AAPP24426) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ALAS2 |
| Uniprot ID |
P22557 |
| Protein Name |
5-aminolevulinate synthase, erythroid-specific, mitochondrial |
| Protein Accession # |
NP_001033056 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001037967 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ALAS2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-ALAS2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T |
|
