| Product Number |
ARP41883_P050 |
| Product Page |
www.avivasysbio.com/rhobtb1-antibody-middle-region-arp41883-p050.html |
| Name |
RHOBTB1 Antibody - middle region (ARP41883_P050) |
| Protein Size (# AA) |
696 amino acids |
| Molecular Weight |
77kDa |
| NCBI Gene Id |
9886 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Rho-related BTB domain containing 1 |
| Alias Symbols |
KIAA0740, MGC33059, MGC33841 |
| Peptide Sequence |
Synthetic peptide located within the following region: DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Beder,L.B., (2006) J. Cancer Res. Clin. Oncol. 132 (1), 19-27 |
| Description of Target |
RHOBTB1 belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system.The protein encoded by this gene belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system. Alternate transcriptional splice variants have been characterized. |
| Protein Interactions |
HSP90AA1; CUL3; COPS5; COPS6; CUL5; Lrrc41; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RHOBTB1 (ARP41883_P050) antibody |
| Blocking Peptide |
For anti-RHOBTB1 (ARP41883_P050) antibody is Catalog # AAP41883 (Previous Catalog # AAPP24420) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RHOBTB1 |
| Uniprot ID |
O94844 |
| Protein Name |
Rho-related BTB domain-containing protein 1 |
| Protein Accession # |
NP_055651 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014836 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RHOBTB1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Zebrafish: 93% |
| Image 1 | Human Intestine
 | Rabbit Anti-RHOBTB1 Antibody
Catalog Number: ARP41883
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 2 | Human Jurkat
 | WB Suggested Anti-RHOBTB1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 3 | Jurkat
 | Host: Rabbit
Target Name: RHOBTB1
Sample Type: Jurkat
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 4.0ug/mL
Peptide Concentration: 2.0ug/mL
Lysate Quantity: 25ug/lane
Gel Concentration: 12% |
|
