CES1 Antibody - C-terminal region (ARP41878_T100)

• Product Number: ARP41878_T100
• Name: CES1 Antibody - C-terminal region (ARP41878_T100)
• Protein Size (# AA): 567 amino acids
• Molecular Weight: 63 kDa
• NCBI Gene Id: 1066
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Carboxylesterase 1
• Alias Symbols: CEH, REH, TGH, ACAT, CE-1, CES2, HMSE, SES1, HMSE1, PCE-1, hCE-1
• Peptide Sequence: Synthetic peptide located within the following region: ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Alam,M., (2006) J. Lipid Res. 47 (2), 375-383
• Description of Target: CES1 is one of the enzymes responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. This enzyme is known to hydrolyze aromatic and aliphatic esters and is necessary for cellular cholesterol esterification. It may also play a role in detoxification in the lung and/or protection of the central nervous system from ester or amide compounds. Carboxylesterase deficiency may be associated with non-Hodgkin lymphoma or B-cell lymphocytic leukemia.Carboxylesterase 1 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. This enzyme is known to hydrolyze aromatic and aliphatic esters and is necessary for cellular cholesterol esterification. It may also play a role in detoxification in the lung and/or protection of the central nervous system from ester or amide compounds. Carboxylesterase deficiency may be associated with non-Hodgkin lymphoma or B-cell lymphocytic leukemia. Three transcript variants encoding three different isoforms have been found for this gene.
• Protein Interactions: BMPR2; GUSB; CES1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CES1 (ARP41878_T100) antibody is Catalog # AAP41878 (Previous Catalog # AAPP24415)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CES1
• Uniprot ID: P23141
• Protein Name: Liver carboxylesterase 1
• Sample Type Confirmation:

  CES1 is supported by BioGPS gene expression data to be expressed in PANC1

• Protein Accession #: NP_001020365
• Purification: Protein A purified
• Nucleotide Accession #: NM_001025194
• Tested Species Reactivity: Human
• Gene Symbol: CES1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 83%; Human: 100%; Mouse: 91%; Rabbit: 92%; Rat: 93%
• Image 1:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.