Product Number |
ARP41876_P050 |
Product Page |
www.avivasysbio.com/dhodh-antibody-n-terminal-region-arp41876-p050.html |
Name |
DHODH Antibody - N-terminal region (ARP41876_P050) |
Protein Size (# AA) |
395 amino acids |
Molecular Weight |
43kDa |
NCBI Gene Id |
1723 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Dihydroorotate dehydrogenase (quinone) |
Alias Symbols |
URA1, POADS, DHOdehase |
Peptide Sequence |
Synthetic peptide located within the following region: GEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kimura,K., (2006) Genome Res. 16 (1), 55-65 |
Description of Target |
DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Protein Interactions |
UBC; TMED10; MT2A; FKBP8; SSBP1; SDHA; PLP2; OGDH; NDUFS8; HNRNPM; ILF3; CYC1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DHODH (ARP41876_P050) antibody |
Blocking Peptide |
For anti-DHODH (ARP41876_P050) antibody is Catalog # AAP41876 (Previous Catalog # AAPP24413) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DHODH |
Uniprot ID |
Q02127 |
Protein Name |
Dihydroorotate dehydrogenase (quinone), mitochondrial |
Sample Type Confirmation |
DHODH is supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_001352 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001361 |
Tested Species Reactivity |
Human |
Gene Symbol |
DHODH |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Goat: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Yeast: 86%; Zebrafish: 85% |
Image 1 | Human HepG2
| WB Suggested Anti-DHODH Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysateDHODH is supported by BioGPS gene expression data to be expressed in HepG2 |
|