FECH Antibody - N-terminal region (ARP41865_P050)

Data Sheet
 
Product Number ARP41865_P050
Product Page www.avivasysbio.com/fech-antibody-n-terminal-region-arp41865-p050.html
Name FECH Antibody - N-terminal region (ARP41865_P050)
Protein Size (# AA) 429 amino acids
Molecular Weight 48 kDa
NCBI Gene Id 2235
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ferrochelatase
Alias Symbols EPP, FCE, EPP1
Peptide Sequence Synthetic peptide located within the following region: QHAQGAKPQVQPQKRYESNIRKPKTGILMLNMGGPETLGDVHDFLLRLFL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Collin,C., (2005) Blood 106 (3), 1098-1104
Description of Target Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria.Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.
Protein Interactions PPP2R1A; UBC; NEDD8; MDM2; FBXO6; gag-pol; COPS5; COPS6; CUL3; ELAVL1; MINOS1; MME; USP42; USP20; ABCB7; FECH;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FECH (ARP41865_P050) antibody
Blocking Peptide For anti-FECH (ARP41865_P050) antibody is Catalog # AAP41865 (Previous Catalog # AAPP24402)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FECH
Uniprot ID Q8NAN0
Protein Name Ferrochelatase, mitochondrial
Sample Type Confirmation

FECH is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_001012533
Purification Affinity Purified
Nucleotide Accession # NM_001012515
Tested Species Reactivity Human
Gene Symbol FECH
Predicted Species Reactivity Human, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Rat: 86%
Image 1
Human Liver
Rabbit Anti-FECH Antibody
Catalog Number: ARP41865
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hepatocytes
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com