| Product Number |
ARP41861_P050 |
| Product Page |
www.avivasysbio.com/cyp4a22-antibody-n-terminal-region-arp41861-p050.html |
| Name |
CYP4A22 Antibody - N-terminal region (ARP41861_P050) |
| Protein Size (# AA) |
519 amino acids |
| Molecular Weight |
57kDa |
| NCBI Gene Id |
284541 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cytochrome P450, family 4, subfamily A, polypeptide 22 |
| Alias Symbols |
RP1-18D14.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Bellamine,A., (2003) Arch. Biochem. Biophys. 409 (1), 221-227 |
| Description of Target |
CYP4A22 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part of a cluster of cytochrome P450 genes on chromosome 1p33. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CYP4A22 (ARP41861_P050) antibody |
| Blocking Peptide |
For anti-CYP4A22 (ARP41861_P050) antibody is Catalog # AAP41861 (Previous Catalog # AAPS11010) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CYP4A22 |
| Uniprot ID |
Q5TCH4 |
| Protein Name |
Cytochrome P450 4A22 |
| Protein Accession # |
NP_001010969 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001010969 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CYP4A22 |
| Predicted Species Reactivity |
Human, Rat, Cow |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Human: 100%; Rat: 79% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-CYP4A22 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
| | Image 2 | Human Kidney
 | Rabbit Anti-CYP4A22 Antibody
Catalog Number: ARP41861
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
|
