| Product Number |
ARP41852_T100 |
| Product Page |
www.avivasysbio.com/eef1aknmt-antibody-c-terminal-region-arp41852-t100.html |
| Name |
EEF1AKNMT Antibody - C-terminal region (ARP41852_T100) |
| Protein Size (# AA) |
543 amino acids |
| Molecular Weight |
60kDa |
| NCBI Gene Id |
51603 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
eEF1A lysine and N-terminal methyltransferase |
| Alias Symbols |
feat, DFNM1, CGI-01, DFNB26, DFNB26M, METTL13, KIAA0859, 5630401D24Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954 |
| Protein Interactions |
UBC; SNRPA; VPS52; SUMO2; NTMT1; CUL3; MYC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EEF1AKNMT (ARP41852_T100) antibody |
| Blocking Peptide |
For anti-EEF1AKNMT (ARP41852_T100) antibody is Catalog # AAP41852 (Previous Catalog # AAPS11001) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human KIAA0859 |
| Uniprot ID |
Q8N6R0-1 |
| Protein Name |
methyltransferase-like protein 13 |
| Protein Accession # |
NP_001007240 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001007239 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EEF1AKNMT |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-KIAA0859 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate |
|
|
