OR5T2 Antibody - C-terminal region (ARP41848_P050)

• Product Number: ARP41848_P050
• Name: OR5T2 Antibody - C-terminal region (ARP41848_P050)
• Protein Size (# AA): 359 amino acids
• Molecular Weight: 39kDa
• NCBI Gene Id: 219464
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Olfactory receptor, family 5, subfamily T, member 2
• Alias Symbols: OR11-177
• Peptide Sequence: Synthetic peptide located within the following region: DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Malnic,B., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (8), 2584-2589
• Description of Target: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-OR5T2 (ARP41848_P050) antibody is Catalog # AAP41848 (Previous Catalog # AAPP10896)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human OR5T2
• Uniprot ID: Q6IFC8
• Protein Name: Olfactory receptor 5T2
• Protein Accession #: NP_001004746
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001004746
• Tested Species Reactivity: Human
• Gene Symbol: OR5T2
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-OR5T2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate