| Product Number |
ARP41827_P050 |
| Product Page |
www.avivasysbio.com/npy1r-antibody-middle-region-arp41827-p050.html |
| Name |
NPY1R Antibody - middle region (ARP41827_P050) |
| Protein Size (# AA) |
384 amino acids |
| Molecular Weight |
44 kDa |
| NCBI Gene Id |
4886 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Neuropeptide Y receptor Y1 |
| Alias Symbols |
NPYR, NPY1-R |
| Peptide Sequence |
Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Domschke,K., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2007) In press |
| Description of Target |
Neuropeptide Y (NPY) is one of the most abundant neuropeptides in the mammalian nervous system and exhibits a diverse range of important physiologic activities, including effects on psychomotor activity, food intake, regulation of central endocrine secretion, and potent vasoactive effects on the cardiovascular system. Two major subtypes of NPY (Y1 and Y2) have been defined by pharmacologic criteria. NPY receptors, such as NPY1R, have been identified in a variety of tissues, including brain, spleen, small intestine, kidney, testis, placenta, and aortic smooth muscle (Herzog et al., 1992 [PubMed 1321422]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
ATP13A2; LSM7; PYY; NPY; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NPY1R (ARP41827_P050) antibody |
| Additional Information |
IHC Information: Human Tonsil (formalin-fixed, paraffin-embedded) stained with NPY1R antibody ARP41827_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen. |
| Blocking Peptide |
For anti-NPY1R (ARP41827_P050) antibody is Catalog # AAP41827 (Previous Catalog # AAPP10875) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NPY1R |
| Uniprot ID |
P25929 |
| Protein Name |
Neuropeptide Y receptor type 1 |
| Protein Accession # |
NP_000900 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000909 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
NPY1R |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 93%; Sheep: 93% |
| Image 1 | Human Tonsil
 | Immunohistochemistry with gut tissue |
|
| Image 2 | Human Tonsil
 | Immunohistochemistry with gut tissue |
|
| Image 3 | Mouse
 | Immunohistochemistry with gut tissue |
|
| Image 4 | Human Testis
 | Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0ug/ml using anti-NPY1R antibody (ARP41827_P050) |
|
| Image 5 |
 | 25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
|
|
