GSTM2 Antibody - N-terminal region (ARP41818_P050)

• Product Number: ARP41818_P050
• Name: GSTM2 Antibody - N-terminal region (ARP41818_P050)
• Protein Size (# AA): 218 amino acids
• Molecular Weight: 26kDa
• NCBI Gene Id: 2946
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Glutathione S-transferase mu 2 (muscle)
• Alias Symbols: GST4, GSTM, GTHMUS, GSTM2-2
• Peptide Sequence: Synthetic peptide located within the following region: TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hayek,T., (2006) Atherosclerosis 184 (2), 404-412
• Description of Target: At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM2 is a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs.
• Protein Interactions: UBC; GSTM3; GSTM2; GSTM1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GSTM2 (ARP41818_P050) antibody is Catalog # AAP41818 (Previous Catalog # AAPP10866)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSTM2
• Uniprot ID: P28161
• Protein Name: Glutathione S-transferase Mu 2
• Protein Accession #: NP_000839
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000848
• Tested Species Reactivity: Human
• Gene Symbol: GSTM2
• Predicted Species Reactivity: Human, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Zebrafish: 79%
• Image 1: Human Skeletal Muscle
  
  Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0ug/ml using anti-GSTM2 antibody (ARP41818_P050)
• Image 2: Human Fetal Liver
  
  Host: Rabbit
  Target Name: GSTM2
  Sample Tissue: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Skeletal muscle
  
  Rabbit Anti-GSTM2 Antibody
  Catalog Number: ARP41818
  Paraffin Embedded Tissue: Human Muscle
  Cellular Data: Skeletal muscle cells
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X