CYP2A13 Antibody - C-terminal region (ARP41803_T100)

Data Sheet
 
Product Number ARP41803_T100
Product Page www.avivasysbio.com/cyp2a13-antibody-c-terminal-region-arp41803-t100.html
Name CYP2A13 Antibody - C-terminal region (ARP41803_T100)
Protein Size (# AA) 494 amino acids
Molecular Weight 54kDa
NCBI Gene Id 1553
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cytochrome P450, family 2, subfamily A, polypeptide 13
Alias Symbols CPAD, CYP2A, CYPIIA13
Peptide Sequence Synthetic peptide located within the following region: DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference He,X.Y., (2004) Drug Metab. Dispos. 32 (12), 1516-1521
Description of Target CYP2A13 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CYP2A13 (ARP41803_T100) antibody
Blocking Peptide For anti-CYP2A13 (ARP41803_T100) antibody is Catalog # AAP41803 (Previous Catalog # AAPP10932)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2A13
Uniprot ID Q16696
Protein Name Cytochrome P450 2A13
Protein Accession # NP_000757
Purification Protein A purified
Nucleotide Accession # NM_000766
Tested Species Reactivity Human
Gene Symbol CYP2A13
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 85%; Rat: 91%; Sheep: 93%
Image 1
Human HepG2
WB Suggested Anti-CYP2A13 Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com