Product Number |
ARP41803_T100 |
Product Page |
www.avivasysbio.com/cyp2a13-antibody-c-terminal-region-arp41803-t100.html |
Name |
CYP2A13 Antibody - C-terminal region (ARP41803_T100) |
Protein Size (# AA) |
494 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
1553 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cytochrome P450, family 2, subfamily A, polypeptide 13 |
Alias Symbols |
CPAD, CYP2A, CYPIIA13 |
Peptide Sequence |
Synthetic peptide located within the following region: DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
He,X.Y., (2004) Drug Metab. Dispos. 32 (12), 1516-1521 |
Description of Target |
CYP2A13 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CYP2A13 (ARP41803_T100) antibody |
Blocking Peptide |
For anti-CYP2A13 (ARP41803_T100) antibody is Catalog # AAP41803 (Previous Catalog # AAPP10932) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CYP2A13 |
Uniprot ID |
Q16696 |
Protein Name |
Cytochrome P450 2A13 |
Protein Accession # |
NP_000757 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000766 |
Tested Species Reactivity |
Human |
Gene Symbol |
CYP2A13 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 85%; Rat: 91%; Sheep: 93% |
Image 1 | Human HepG2
| WB Suggested Anti-CYP2A13 Antibody Titration: 5.0ug/ml Positive Control: HepG2 cell lysate |
|
|