CYP3A7 Antibody - middle region (ARP41801_T100)

Data Sheet
 
Product Number ARP41801_T100
Product Page www.avivasysbio.com/cyp3a7-antibody-middle-region-arp41801-t100.html
Name CYP3A7 Antibody - middle region (ARP41801_T100)
Protein Size (# AA) 503 amino acids
Molecular Weight 57kDa
NCBI Gene Id 1551
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cytochrome P450, family 3, subfamily A, polypeptide 7
Alias Symbols CP37, CYPIIIA7, P450HLp2, P450-HFLA, P-450111A7, P-450(HFL33)
Peptide Sequence Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sim,S.C., (2005) Pharmacogenet. Genomics 15 (9), 625-631
Description of Target CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.This gene, CYP3A7, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Transcript variants have been described, but it is not known whether these transcripts are normally produced.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CYP3A7 (ARP41801_T100) antibody
Blocking Peptide For anti-CYP3A7 (ARP41801_T100) antibody is Catalog # AAP41801 (Previous Catalog # AAPP10849)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CYP3A7
Uniprot ID P24462
Protein Name Cytochrome P450 3A7
Publications

Van Peer, E. et al. Ontogeny of CYP3A and P-glycoprotein in the liver and the small intestine of the Göttingen minipig: an immunohistochemical evaluation. Basic Clin. Pharmacol. Toxicol. 114, 387-94 (2014). 24224644

Protein Accession # NP_000756
Purification Protein A purified
Nucleotide Accession # NM_000765
Tested Species Reactivity Human
Gene Symbol CYP3A7
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 77%; Dog: 75%; Guinea Pig: 83%; Human: 100%; Rat: 85%
Image 1
Human Liver
WB Suggested Anti-CYP3A7 Antibody Titration: 2.5ug/ml
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com