ADH1B Antibody - N-terminal region (ARP41786_P050)

• Product Number: ARP41786_P050
• Name: ADH1B Antibody - N-terminal region (ARP41786_P050)
• Protein Size (# AA): 375 amino acids
• Molecular Weight: 40kDa
• NCBI Gene Id: 125
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Alcohol dehydrogenase 1B (class I), beta polypeptide
• Alias Symbols: ADH2, HEL-S-117
• Peptide Sequence: Synthetic peptide located within the following region: STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ikeda,S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487
• Description of Target: ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. The protein encoded by this gene is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This encoded protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: IRAK3; GNB2L1; PDE4DIP; PML; SERPINA3; YWHAE;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ADH1B (ARP41786_P050) antibody is Catalog # AAP41786 (Previous Catalog # AAPP10920)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ADH1B
• Uniprot ID: P00325
• Protein Name: Alcohol dehydrogenase 1B
• Protein Accession #: NP_000659
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000668
• Tested Species Reactivity: Human
• Gene Symbol: ADH1B
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 93%; Zebrafish: 93%
• Image 1: Human Lung
  
  WB Suggested Anti-ADH1B Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Lung
• Image 2: Human heart
  
  Rabbit Anti-ADH1B Antibody
  Catalog Number: ARP41786_P050
  Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
  Observed Staining: Cytoplasmic
  Primary Antibody Concentration: N/A
  Other Working Concentrations: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec