| Product Number |
ARP41781_T100 |
| Product Page |
www.avivasysbio.com/bdkrb2-antibody-n-terminal-region-arp41781-t100.html |
| Name |
BDKRB2 Antibody - N-terminal region (ARP41781_T100) |
| Protein Size (# AA) |
391 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
624 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Bradykinin receptor B2 |
| Alias Symbols |
B2R, BK2, BK-2, BKR2, BRB2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Michineau,S., (2006) Biochemistry 45 (8), 2699-2707 |
| Description of Target |
BDKRB2 is a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system.This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein. |
| Protein Interactions |
BAG3; ACE; GRK5; GRK6; PRKCD; PTPN11; NOS1; NOS3; GNA11; GRK4; ADRBK2; ADRBK1; AGTR1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-BDKRB2 (ARP41781_T100) antibody |
| Blocking Peptide |
For anti-BDKRB2 (ARP41781_T100) antibody is Catalog # AAP41781 (Previous Catalog # AAPP10915) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human BDKRB2 |
| Uniprot ID |
P30411 |
| Protein Name |
B2 bradykinin receptor |
| Protein Accession # |
NP_000614 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000623 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BDKRB2 |
| Predicted Species Reactivity |
Human, Cow |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-BDKRB2 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate |
|
|
