GSTM1 Antibody - N-terminal region (ARP41769_P050)

• Product Number: ARP41769_P050
• Name: GSTM1 Antibody - N-terminal region (ARP41769_P050)
• Protein Size (# AA): 218 amino acids
• Molecular Weight: 26kDa
• NCBI Gene Id: 2944
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Glutathione S-transferase mu 1
• Alias Symbols: MU, H-B, GST1, GTH4, GTM1, MU-1, GSTM1-1, GSTM1a-1a, GSTM1b-1b
• Peptide Sequence: Synthetic peptide located within the following region: KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Sobti,R.C., (2006) Cancer Genet. Cytogenet. 166 (2), 117-123
• Description of Target: Cytosolic and membrane-bound forms of glutathione S-transferase are two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM1 a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene.
• Protein Interactions: GSTM3; UBC; IQCB1; MAP3K5; GSTM2; GSTM1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GSTM1 (ARP41769_P050) antibody is Catalog # AAP41769 (Previous Catalog # AAPP10817)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSTM1
• Uniprot ID: P46439
• Protein Name: Glutathione S-transferase Mu 5
• Publications:

  Bates, D. J. et al. MicroRNA regulation in Ames dwarf mouse liver may contribute to delayed aging. Aging Cell 9, 1-18 (2010). 19878148

  Seasonal heat stress affects adipose tissue proteome toward enrichment of the Nrf2-mediated oxidative stress response in late-pregnant dairy cows. J Proteomics. 158, 52-61 (2017). 28238905

• Protein Accession #: NP_000552
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000561
• Tested Species Reactivity: Human
• Gene Symbol: GSTM1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
• Image 1: Human Fetal Lung
  
  Host: Rabbit
  Target Name: GSTM1
  Sample Tissue: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml