GNAS Antibody - C-terminal region (ARP41765_T100)

• Product Number: ARP41765_T100
• Name: GNAS Antibody - C-terminal region (ARP41765_T100)
• Protein Size (# AA): 380 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 2778
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: GNAS complex locus
• Alias Symbols: AHO, GSA, GSP, POH, GPSA, NESP, SCG6, SgVI, GNAS1, PITA3, C20orf45
• Peptide Sequence: Synthetic peptide located within the following region: YFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Linglart,A., (2006) Endocrinology 147 (5), 2253-2262
• Description of Target: This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.This gene has a highly complex imprinted expression pattern. It encodes maternally, paternally, and biallelically expressed proteins which are derived from alternatively spliced transcripts with alternate 5' exons. Each of the upstream exons is within a differentially methylated region, commonly found in imprinted genes. However, the close proximity (14 kb) of two oppositely expressed promoter regions is unusual. In addition, one of the alternate 5' exons introduces a frameshift relative to the other transcripts, resulting in one isoform which is structurally unrelated to the others. An antisense transcript exists, and may regulate imprinting in this region. Mutations in this gene result in pseudohypoparathyroidism type 1a (PHP1a), which has an atypical autosomal dominant inheritance pattern requiring maternal transmission for full penetrance. There are RefSeqs representing four transcript variants of this gene. Other transcript variants including four additional exons have been described; however, their full length sequences have not been determined.
• Protein Interactions: PANX1; AXIN1; UBC; FUS; OPTN; PTGIR; HLA-A; ADRB2; NUCB2; NUCB1; LAMTOR1; SLC25A12; GNAQ; GNA11; UBD; TBXA2R; GNB1; AVPR2; SUMO1; PCK1; Ric8b; GNG2; CALM1; Haus1; Trim69; Cbx1; RIC8A; TTC1; SNX13; ADCY5; CRHR1; PTGDR; TSHR; CAV3; HTR6; RGS2; ADCY6; VIPR1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GNAS (ARP41765_T100) antibody is Catalog # AAP41765 (Previous Catalog # AAPP10904)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GNAS
• Uniprot ID: Q5FWY2
• Protein Name: GNAS complex locus EMBL AAH89157.2
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that GNAS is expressed in Jurkat

• Protein Accession #: NP_536351
• Purification: Protein A purified
• Nucleotide Accession #: NM_080426
• Tested Species Reactivity: Human
• Gene Symbol: GNAS
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 83%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Image 1: Human Jurkat
  
  WB Suggested Anti-GNAS Antibody Titration: 2.5ug/ml
  Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that GNAS is expressed in Jurkat