KRT17 Antibody - C-terminal region (ARP41733_P050)

Data Sheet
 
Product Number ARP41733_P050
Product Page www.avivasysbio.com/krt17-antibody-c-terminal-region-arp41733-p050.html
Name KRT17 Antibody - C-terminal region (ARP41733_P050)
Protein Size (# AA) 432 amino acids
Molecular Weight 48kDa
NCBI Gene Id 3872
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Keratin 17
Alias Symbols PC, K17, PC2, 39.1, CK-17, PCHC1
Peptide Sequence Synthetic peptide located within the following region: IATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKVISSREQVHQT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Rual,J.F., (2005) Nature 437 (7062), 1173-1178
Description of Target KRT17 is type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in its gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.KRT17 encodes the type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in this gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.
Protein Interactions TRIM69; UBC; MDM2; IGF2BP3; IKBKG; PA2G4; CRYZ; KDM1A; GRB2; Iqcb1; Nphp1; Invs; CALR; ILF3; UBASH3B; SHC1; PIK3R2; INPPL1; EPS15; CRK; AP2M1; CBL; COPS5; SUMO2; YWHAQ; APC; USP1; UCHL1; CCDC85B; KRT7; KRT6A; EGFR; KRT72; KRT8;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KRT17 (ARP41733_P050) antibody
Blocking Peptide For anti-KRT17 (ARP41733_P050) antibody is Catalog # AAP41733 (Previous Catalog # AAPP24376)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KRT17
Uniprot ID Q04695
Protein Name Keratin, type I cytoskeletal 17
Protein Accession # NP_000413
Purification Affinity Purified
Nucleotide Accession # NM_000422
Tested Species Reactivity Human
Gene Symbol KRT17
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
Image 1
Human Lung
Rabbit Anti-KRT17 Antibody
Catalog Number: ARP41733
Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human HepG2
WB Suggested Anti-KRT17 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Image 3
Human Kidney
Rabbit Anti-KRT17 Antibody
Catalog Number: ARP41733
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 4
Human Hela
WB Suggested Anti-KRT17 antibody Titration: 1 ug/mL
Sample Type: Human Hela
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com