| Product Number |
ARP41727_P050 |
| Product Page |
www.avivasysbio.com/hsd17b1-antibody-n-terminal-region-arp41727-p050.html |
| Name |
HSD17B1 Antibody - N-terminal region (ARP41727_P050) |
| Protein Size (# AA) |
328 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
3292 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Hydroxysteroid (17-beta) dehydrogenase 1 |
| Alias Symbols |
E2DH, HSD17, EDHB17, EDH17B2, SDR28C1, 17-beta-HSD, 20-alpha-HSD |
| Peptide Sequence |
Synthetic peptide located within the following region: MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tsuchiya,M., (2005) Hum. Reprod. 20 (4), 974-978 |
| Description of Target |
HSD17B1 is favors the reduction of estrogens and androgens. It also has 20-alpha-HSD activity. It uses preferentially NADH. |
| Protein Interactions |
HSD17B1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HSD17B1 (ARP41727_P050) antibody |
| Blocking Peptide |
For anti-HSD17B1 (ARP41727_P050) antibody is Catalog # AAP41727 (Previous Catalog # AAPP24370) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B1 |
| Uniprot ID |
P14061 |
| Protein Name |
Estradiol 17-beta-dehydrogenase 1 |
| Protein Accession # |
NP_000404 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000413 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
HSD17B1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 91%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse Heart
 | Host: Mouse
Target Name: HSD17B1
Sample Tissue: Mouse Heart
Antibody Dilution: 1ug/ml |
|
| Image 2 | Human Jurkat
 | WB Suggested Anti-HSD17B1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 3 | Human Kidney
 | Rabbit Anti-HSD17B1 Antibody
Catalog Number: ARP41727
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
