Product Number |
ARP41710_T100 |
Product Page |
www.avivasysbio.com/sts-antibody-c-terminal-region-arp41710-t100.html |
Name |
STS Antibody - C-terminal region (ARP41710_T100) |
Protein Size (# AA) |
583 amino acids |
Molecular Weight |
64kDa |
NCBI Gene Id |
412 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Steroid sulfatase (microsomal), isozyme S |
Alias Symbols |
ES, ASC, XLI, ARSC, SSDD, ARSC1 |
Peptide Sequence |
Synthetic peptide located within the following region: LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSW |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kimura,K., (2006) Genome Res. 16 (1), 55-65 |
Description of Target |
STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosisThe protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI). |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-STS (ARP41710_T100) antibody |
Blocking Peptide |
For anti-STS (ARP41710_T100) antibody is Catalog # AAP41710 (Previous Catalog # AAPP24353) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human STS |
Uniprot ID |
P08842 |
Protein Name |
Steryl-sulfatase |
Protein Accession # |
NP_000342 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000351 |
Tested Species Reactivity |
Human |
Gene Symbol |
STS |
Predicted Species Reactivity |
Human, Rat, Cow, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 77%; Horse: 100%; Human: 100%; Rat: 77% |
Image 1 | Human Placenta
| WB Suggested Anti-STS Antibody Titration: 5.0ug/ml Positive Control: Human Placenta |
|
Image 2 | Hela, THP-1
| Host: Rabbit Target: STS Positive control (+): Hela (HL) Negative control (-): THP-1 (N30) Antibody concentration: 3ug/ml |
|