STS Antibody - C-terminal region (ARP41710_T100)

Data Sheet
 
Product Number ARP41710_T100
Product Page www.avivasysbio.com/sts-antibody-c-terminal-region-arp41710-t100.html
Name STS Antibody - C-terminal region (ARP41710_T100)
Protein Size (# AA) 583 amino acids
Molecular Weight 64kDa
NCBI Gene Id 412
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Steroid sulfatase (microsomal), isozyme S
Alias Symbols ES, ASC, XLI, ARSC, SSDD, ARSC1
Peptide Sequence Synthetic peptide located within the following region: LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSW
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Description of Target STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosisThe protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI).
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-STS (ARP41710_T100) antibody
Blocking Peptide For anti-STS (ARP41710_T100) antibody is Catalog # AAP41710 (Previous Catalog # AAPP24353)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human STS
Uniprot ID P08842
Protein Name Steryl-sulfatase
Protein Accession # NP_000342
Purification Protein A purified
Nucleotide Accession # NM_000351
Tested Species Reactivity Human
Gene Symbol STS
Predicted Species Reactivity Human, Rat, Cow, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 77%; Horse: 100%; Human: 100%; Rat: 77%
Image 1
Human Placenta
WB Suggested Anti-STS Antibody Titration: 5.0ug/ml
Positive Control: Human Placenta
Image 2
Hela, THP-1
Host: Rabbit
Target: STS
Positive control (+): Hela (HL)
Negative control (-): THP-1 (N30)
Antibody concentration: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com