| Product Number |
ARP41705_T100 |
| Product Page |
www.avivasysbio.com/rhag-antibody-middle-region-arp41705-t100.html |
| Name |
RHAG Antibody - middle region (ARP41705_T100) |
| Protein Size (# AA) |
409 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
6005 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Rh-associated glycoprotein |
| Alias Symbols |
OHS, RH2, OHST, RHNR, Rh50, CD241, RH50A, Rh50GP, SLC42A1 |
| Peptide Sequence |
Synthetic peptide located within the following region: FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Norberg,A., (2006) Neurosci. Lett. 396 (2), 137-142 |
| Description of Target |
The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30 kD, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kD, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.The Rh blood group antigens (MIM 111700) are associated with human erythrocyte membrane proteins of approximately 30 kD, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kD, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47 (MIM 601028), LW (MIM 111250), glycophorin B (MIM 111740), and play a critical role in the Rh50 glycoprotein.[supplied by OMIM]. |
| Protein Interactions |
CD47; ANK1; GYPB; ICAM4; SLC4A1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RHAG (ARP41705_T100) antibody |
| Blocking Peptide |
For anti-RHAG (ARP41705_T100) antibody is Catalog # AAP41705 (Previous Catalog # AAPP24348) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RHAG |
| Uniprot ID |
Q02094 |
| Protein Name |
Ammonium transporter Rh type A |
| Protein Accession # |
NP_000315 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000324 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RHAG |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 77%; Rabbit: 93%; Rat: 85% |
| Image 1 | Human HepG2
 | WB Suggested Anti-RHAG Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
|
