HMGCL Antibody - C-terminal region (ARP41687_P050)

• Product Number: ARP41687_P050
• Name: HMGCL Antibody - C-terminal region (ARP41687_P050)
• Protein Size (# AA): 325 amino acids
• Molecular Weight: 36kDa
• NCBI Gene Id: 3155
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: 3-hydroxymethyl-3-methylglutaryl-CoA lyase
• Alias Symbols: HL
• Peptide Sequence: Synthetic peptide located within the following region: LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fu,Z., (2006) J. Biol. Chem. 281 (11), 7526-7532
• Description of Target: The function remains unknown.
• Protein Interactions: GTF2B; PEX5; ADAMTS10; RNF126; ARL6IP1; DNAJA1; HES1; MS4A7;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HMGCL (ARP41687_P050) antibody is Catalog # AAP41687 (Previous Catalog # AAPP24330)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HMGCL
• Uniprot ID: P35914
• Protein Name: Hydroxymethylglutaryl-CoA lyase, mitochondrial
• Protein Accession #: NP_000182
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000191
• Tested Species Reactivity: Human
• Gene Symbol: HMGCL
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85%
• Image 1: Human HepG2
  
  WB Suggested Anti-HMGCL Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate